Skip to content

niejiawei19/ByProt

 
 

Repository files navigation

ByProt

PyTorch Lightning Config: Hydra Template
Paper

ByProt is a versatile toolkit designed for generative learning in protein research. It currently focuses primarily on structure-based sequence design (a.k.a., fixedbb), offering the following key features:

  • Efficient non-autoregressive ProteinMPNN variant: ByProt provides an efficient and effective non-autoregressive variant of ProteinMPNN, a powerful tool for protein fixed-backbone sequence design.
  • Official implementation of LM-Design : ByProt serves as the official implementation of LM-Design, the state-of-the-art protein sequence design model from the paper titled "Structure-informed Language Models Are Protein Designers," which was presented at ICML 2023 (oral). For more details, please refer to the paper.

LM-Design

We are continuously expanding ByProt's capabilities to encompass a broader range of tasks and features. Stay tuned for updates as we strive to provide an even more comprehensive toolkit for protein research.

Installation

# clone project git clone --recursive https://url/to/this/repo/ByProt.git cd ByProt # create conda virtual environment env_name=ByProt conda create -n ${env_name} python=3.7 pip conda activate ${env_name} # automatically install everything else bash install.sh

Structure-based protein sequence design (inverse folding)

Pretrained model weights (Zenodo)

model training data checkpoint
protein_mpnn_cmlm cath_4.2 link
lm_design_esm1b_650m cath_4.2 link
lm_design_esm2_650m cath_4.2 link
lm_design_esm2_650m multichain link

Data

Download the preproceesd CATH datasets

bash scripts/download_cath.sh

Go check configs/datamodule/cath_4.*.yaml and set data_dir to the path of the downloaded CATH data.

Dowload PDB complex data (multichain)

This dataset curated protein (multichain) complexies from Protein Data Bank (PDB). It is provided by Robust deep learning-based protein sequence design using ProteinMPNN. See their github page for more details.

bash scripts/download_multichain.sh

Go check configs/datamodule/multichain.yaml and set data_dir to the path of the downloaded multichain data.

OK we now get everything ready and can start to train a model.

Training

In the following sections, we will use CATH 4.2 dataset as an runing example. You can likewise build your models on the multichain dataset to accommodate protein complexies.

Example 1: Non-autoregressive (NAR) ProteinMPNN baseline

Training NAR ProteinMPNN with conditional masked language modeling (CMLM)

export CUDA_VISIBLE_DEVICES=0 # or use multi-gpu training when you want: # export CUDA_VISIBLE_DEVICES=0,1 exp=fixedbb/protein_mpnn_cmlm dataset=cath_4.2 name=fixedbb/${dataset}/protein_mpnn_cmlm python ./train.py \ experiment=${exp} datamodule=${dataset} name=${name} \ logger=tensorboard trainer=ddp_fp16 

Some flags for training:

Argument Usage
experiment experiment config. see ByProt/configs/experiment/ folder
datamodule dataset config. see ByProt/configs/datamodule folder
name experiment name, deciding the directory path your experiment saving to, e.g., /root/research/projects/ByProt/run/logs/${name}
logger config of which ml experiment logger to use, e.g., tensorboard.
train.force_restart set to true to force retrain the experiment under ${name}. otherwise will resume training from the last checkpoint.

Example 2: LM-Design

Training LM-Design upon ESM-1b 650M.

Training would take approxmiately 6 hours on one A100 GPU.

exp=fixedbb/lm_design_esm1b_650m dataset=cath_4.2 name=fixedbb/${dataset}/lm_design_esm1b_650m ./train.py \ experiment=${exp} datamodule=${dataset} name=${name} \ logger=tensorboard trainer=ddp_fp16 

Building LM-Design upon ESM-2 series using exp=fixedbb/lm_design_esm2*. Please check ByProt/configs/experiment/fixedbb.

Evaluation/inference on valid/test datasets

dataset=cath_4.2 # name=fixedbb/${dataset}/protein_mpnn_cmlm name=fixedbb/${dataset}/lm_design_esm1b_650m exp_path=/root/research/projects/ByProt/run/logs/${name} python ./test.py \  experiment_path=${exp_path} \ data_split=test ckpt_path=best.ckpt mode=predict \ task.generator.max_iter=5

Some flags for generation

Argument Usage
experiment_path folder that saves experiment (.hydra, checkpoints, tensorboard, etc)
data_split valid or test dataset.
mode predict for generating sequence & calculating amino acid sequence recovery; test for evaluation for nll, ppl
task.generator arguments for sequence generator/sampler
- max_iter=<int> maximum decoding iteration (default: 5 for LM-Design, 1 for ProtMPNN-CMLM)
- strategy=[denoise, mask_predict] decoding strategy. (default: denoise for LM-Design, mask_predict for ProtMPNN-CMLM)
- temperature=<float> temperature for sampling. set to 0 to disable for deterministic sampling (default: 0)
- eval_sc=<bool> additional evaluating scTM score using ESMFold. (default: false)

Designing sequences from a pdb file using a trained model in Notebook

Example 1: ProteinMPNN-CMLM

from byprot.utils.config import compose_config as Cfg from byprot.tasks.fixedbb.designer import Designer # 1. instantialize designer exp_path = "/root/research/projects/ByProt/run/logs/fixedbb/cath_4.2/protein_mpnn_cmlm" cfg = Cfg( cuda=True, generator=Cfg( max_iter=1, strategy='mask_predict', temperature=0, eval_sc=False, ) ) designer = Designer(experiment_path=exp_path, cfg=cfg) # 2. load structure from pdb file pdb_path = "/root/research/projects/ByProt/data/3uat_variants/3uat_GK.pdb" designer.set_structure(pdb_path) # 3. generate sequence from the given structure designer.generate() # 4. calculate evaluation metircs designer.calculate_metrics() ## prediction: SSYNPPILLLGPFAEELEEELVEENPERAGRPVPFTTEPPSPDETEGETYLYISSLEEAEELIESNRFLEAGEENNELVGISLEAIRSVARAGKLAILDTGGEAVEKLEEANIEPIVIFLVPKSVEDVRRVFPDLTEEEAEELTSEDEELLEEFKELLDAVVSGSTLEEVLEEIREVIEEASS ## recovery: 0.37158469945355194

Example 2: LM-Design

from byprot.utils.config import compose_config as Cfg from byprot.tasks.fixedbb.designer import Designer # 1. instantialize designer exp_path = "/root/research/projects/ByProt/run/logs/fixedbb/cath_4.2/lm_design_esm2_650m" cfg = Cfg( cuda=True, generator=Cfg( max_iter=5, strategy='denoise', temperature=0, eval_sc=False, ) ) designer = Designer(experiment_path=exp_path, cfg=cfg) # 2. load structure from pdb file pdb_path = "/root/research/projects/ByProt/data/3uat_variants/3uat_GK.pdb" designer.set_structure(pdb_path) # 3. generate sequence from the given structure designer.generate() # you can override generator arguments by passing generator_args, e.g., designer.generate( generator_args={ 'max_iter': 5, 'temperature': 0.1, } ) # 4. calculate evaluation metircs designer.calculate_metrics() ## prediction: LNYTRPVIILGPFKDRMNDDLLSEMPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREEMEKDIQNHEFIEAGEYNDNLYGTSIESVREVAMEGKHCILDVSGNAIQRLIKADLYPIAIFIRPRSVENVREMNKRLTEEQAKEIFERAQELEEEFMKYFTAIVEGDTFEEIYNQVKSIIEEESG ## recovery: 0.7595628415300546

** Example 3: Inpainting ** For some use cases, you may want to do inpainting on some segments of interest only while the rest of the protein remains the same (e.g., designing antibody CDRs). Here is a simple example with inpaint interface:

pdb_path = "/root/research/projects/ByProt/data/pdb_samples/5izu_proc.pdb" designer.set_structure(pdb_path) start_ids = [1, 50] end_ids = [10, 100] for i in range(5): out, ori_seg, designed_seg = designer.inpaint( start_ids=start_ids, end_ids=end_ids, generator_args={'temperature': 1.0} ) print(designed_seg) print('Original Segments:') print(ori_seg)

The output looks like:

loading backbone structure from /root/research/projects/ByProt/data/pdb_samples/5izu_proc.pdb. [['MVKSLFRHRT'], ['DEPIEEFTPTPAFPALQRLSSVDVEGVAWRAGLRTGDFLLEVNGVNVVKVG']] [['MTKALFRHQT'], ['ETPIEEFTPTPAFPALQHLSSVDVEGAAYRAGLRTGDFLIEVNGVNVVKVG']] [['STESLFRHAT'], ['ETPIEEFTPTPAFPALQHLSSVDVEGVAWRAGLRTGDFLIEVNGINVVKVG']] [['ATARMFRHLT'], ['ETPIEEFTPTPAFPALQYLSSVDVEGVAWRAGLKTGDFLIEVNGVNVVKVG']] [['ARKAKFRRYT'], ['ETPIEEFTPTPAFPALQVLSSVDVEGVAWRAGMRTGDFLLEVNGVNVVKVG']] [['ADARLFREYT'], ['ETPIEEFTPTPAFPALQHLSAVDVEGVAWRAGLLTGDFLIEVNGVNVVKVG']] [['ALRALFKHST'], ['DTPIEEFTPTPAFPALQYMSSVEVEGVAWRAGLRTGDFLIEVNGVNVVKVG']] [['MLKMLFRHYT'], ['ETPIEEFTPTPAFPALQYLSSVDIDGMAWRAGLRTGDFLIEVNGDNVVKVG']] [['ADKALFRHHT'], ['STPIEEFTPTPAFPALQYLESVDVDGVAYRAGLCTGDFLIEVNGVNVVKVG']] [['AAAAAFRHST'], ['KTPIEEFTPTPAFPALQYLSRVEVDGMAWRAGLRTGDFLLEVNGVNVVRVG']] Original Segments: [['RTKRLFRHYT'], ['ETPIEEFTPTPAFPALQYLESVDVEGVAWRAGLRTGDFLIEVNGVNVVKVG']]

Acknowledgements

ByProt extends its gratitude to the following projects and individuals:

ByProt draws inspiration and leverages/modifies implementations from the following repositories:

We express our sincere appreciation to the authors of these repositories for their invaluable contributions to the development of ByProt.

Citation

@inproceedings{zheng2023lm_design,  title={Structure-informed Language Models Are Protein Designers},  author={Zheng, Zaixiang and Deng, Yifan and Xue, Dongyu and Zhou, Yi and YE, Fei and Gu, Quanquan},  booktitle={International Conference on Machine Learning},  year={2023} }

About

No description, website, or topics provided.

Resources

License

Stars

Watchers

Forks

Releases

No releases published

Packages

 
 
 

Contributors

Languages

  • Python 99.7%
  • Shell 0.3%