13
\$\begingroup\$

Related: Iterated phi(n) function.

Your challenge is to compute the iterated phi function:

f(n) = number of iterations of φ for n to reach 1. 

Where φ is Euler's totient function.

Related OEIS.

Here's the graph of it:

enter image description here


Rules:

Your goal is to output f(n) from n=2 to n=100.

This is code-golf, so shortest code wins.

Here's the values you can check against:

1, 2, 2, 3, 2, 3, 3, 3, 3, 4, 3, 4, 3, 4, 4, 5, 3, 4, 4, 4, 4, 5, 4, 5, 4, 4, 4, 5, 4, 5, 5, 5, 5, 5, 4, 5, 4, 5, 5, 6, 4, 5, 5, 5, 5, 6, 5, 5, 5, 6, 5, 6, 4, 6, 5, 5, 5, 6, 5, 6, 5, 5, 6, 6, 5, 6, 6, 6, 5, 6, 5, 6, 5, 6, 5, 6, 5, 6, 6, 5, 6, 7, 5, 7, 5, 6, 6, 7, 5, 6, 6, 6, 6, 6, 6, 7, 5, 6, 6 
\$\endgroup\$
17
  • \$\begingroup\$ @LuisMendo Fixed, and also added graph + values to check against. :-) \$\endgroup\$ Commented Dec 4, 2017 at 16:04
  • 1
    \$\begingroup\$ I've edited in the kolmogorov-complexity tag, as this is essentially outputting a fixed value \$\endgroup\$ Commented Dec 4, 2017 at 16:10
  • 1
    \$\begingroup\$ @SimplyBeautifulArt First prove that there are finitely many values x such that phi(x) is a particular fixed number. \$\endgroup\$ Commented Dec 4, 2017 at 16:31
  • 2
    \$\begingroup\$ This is a nice challenge, but I think it would be better to just ask for a solution to implement f(n), rather than run it on a range of fixed numbers. This also makes a difference between languages with ability to apply functions on ranges with less bytes (partly chameleon challenge?) \$\endgroup\$ Commented Dec 4, 2017 at 16:35
  • 1
    \$\begingroup\$ :P Are you implying I should change the challenge to give you an advantage? Regardless of how these rules are stated, some languages will have an advantage and some won't. @Uriel \$\endgroup\$ Commented Dec 4, 2017 at 16:37

21 Answers 21

10
\$\begingroup\$

Haskell, 53 52 bytes

Thanks nimi for saving 1 byte!

f<$>[2..100] f 1=0 f n=1+f(sum[1|1<-gcd n<$>[1..n]]) 

Try it online!

sum[1|1<-gcd n<$>[1..n]] gives φ(n) (Taken from flawr, thanks!)

f is a recursive function that calculates 1+φ(n) if n is not 1, and outputs 0 if n is 1, as there are no more iterations to be taken to reach 1

Finally f<$>[2..100] creates a list of f applied to each element of [2..100]

\$\endgroup\$
7
\$\begingroup\$

Haskell, 70 69 68 bytes

The function (\n->sum[1|1<-gcd n<$>[1..n]]) is the totient function, which we repeatedly apply in the anonymous function. Thanks @laikoni for -1 byte!

EDIT: I just found out @xnor used this exact totient function in a previous challenge.

length.fst.span(>1).iterate(\n->sum[1|1<-gcd n<$>[1..n]])<$>[2..100] 

Try it online!

\$\endgroup\$
2
  • 1
    \$\begingroup\$ This is pretty short for not having a totient builtin! \$\endgroup\$ Commented Dec 4, 2017 at 16:40
  • 1
    \$\begingroup\$ @LuisMendo H.PWiz found a solution that is even shorter! \$\endgroup\$ Commented Dec 4, 2017 at 17:13
7
\$\begingroup\$

MATL, 16 15 bytes

99:Q"@`_Zptq}x@ 

Try it online!

Explanation

99: % Push [1 2 ... 99] Q % Add 1 element-wise: gives [2 3 ... 100] " % For each k in that array @ % Push k ` % Do...while _Zp % Euler's totient function tq % Duplicate, subtract 1. This is the loop condition } % Finally (execute on loop exit) x % Delete @ % Push latest k % End (implicit) % End (implicit) % Display stack (implicit) 

Old version, 16 bytes

99:Qt"t_Zp]v&X<q 

Try it online!

Explanation

99: % Push [1 2 ... 99] Q % Add 1 element-wise: gives [1 2 ... 100] t" % Duplicate. For each (i.e. do the following 100 times) t % Duplicate _Zp % Euler's totient function, element-wise ] % End v % Concatenate vertically. Gives a 100×100 matrix &X< % Row index of the first minimizing entry for each column. % The minimum is guaranteed to be 1, because the number of % iterations is more than sufficient. q % Subtract 1. Display stack (implicit) 
\$\endgroup\$
4
  • 1
    \$\begingroup\$ The values outputted are off by one, I think Try it online! corrects that (but I've never used MATL before so...) \$\endgroup\$ Commented Dec 4, 2017 at 16:06
  • \$\begingroup\$ Check the end of my post. It provides the expected output, to which you are off by one on each. \$\endgroup\$ Commented Dec 4, 2017 at 16:11
  • \$\begingroup\$ The first 5 values outputted by your current answer are 2 3 3 4 3, when the challenge says they should be 1 2 2 3 2 \$\endgroup\$ Commented Dec 4, 2017 at 16:11
  • \$\begingroup\$ @cairdcoinheringaahing and SimplyBeautifulArt Ah, I see. Thanks! Corrected now \$\endgroup\$ Commented Dec 4, 2017 at 16:13
6
\$\begingroup\$

APL (Dyalog), 50 29 25 bytes

Look 'ma, no built-in totient!

4 bytes saved thanks to @H.PWiz

{⍵=1:0⋄1+∇+/1=⍵∨⍳⍵}¨1+⍳99 

Try it online!

How?

Apparently I went for the longer (and harder) totient formula first. See revisions history.

⍳⍵ - 1 to n

⍵∨ - gcd with n

1= - equal to 1?

+/ - sum 'em all

This is the totient. All the rest is wrapper for the counting (1+∇) and applying on the range 2..100 (¨1+⍳99).

\$\endgroup\$
0
6
\$\begingroup\$

Jelly, 12 11 10 9 8 bytes

³ḊÆṪƬ>1S 

Try it online!

-1 byte thanks to HyperNeutrino!

-1 byte thanks to Mr. Xcoder!

-1 byte thanks to Dennis

How it works

³ḊÆṪƬ>1S - Main link. No arguments ³ - Yield 100 Ḋ - Dequeue. Creates the list [2, 3 ... 99, 100] Ƭ - Until the following produces a repeated value, collecting each loop: ÆṪ - Totient of each >1 - Greater than one? S - Sum the columns 
\$\endgroup\$
12
  • 1
    \$\begingroup\$ @dylnan All three answers output the list of f(n) from 2 to 100, and the question doesn't mention input, so I think this is the correct version \$\endgroup\$ Commented Dec 4, 2017 at 16:09
  • \$\begingroup\$ @dylnan The challenge asks to output f for n=2 to n=100, not just one value. \$\endgroup\$ Commented Dec 4, 2017 at 16:09
  • \$\begingroup\$ You're right, I had read the beginning of the challenge and didn't read the rules part clearly \$\endgroup\$ Commented Dec 4, 2017 at 16:21
  • \$\begingroup\$ And with regards to the code, would it be possible to use # in this case? Something like this (which clearly doesn't work but written by someone who understands the syntax clearly!) \$\endgroup\$ Commented Dec 4, 2017 at 16:23
  • \$\begingroup\$ @dylnan Possibly, but as we're generating a fixed list, to apply over each element, is usually better than #. \$\endgroup\$ Commented Dec 4, 2017 at 16:26
5
\$\begingroup\$

Mathematica, 44 bytes

(i=-1;#+1//.x_:>EulerPhi[++i;x];i)&~Array~99 

-10 bytes from @Misha Lavrov
-2 bytes from @user202729

Try it online!

\$\endgroup\$
0
4
\$\begingroup\$

J REPL, 23 bytes

<:#@(5&p:^:a:)"0|2+i.99 

I haven’t checked, but this probably works in regular J if you define it as a noun (I golfed this on my phone on the REPL).

Built-ins, yo.

I’d say that there are at least 2-3 bytes to shave off (off-by-one because of the way a: works, having to use | as a noop, etc.).

\$\endgroup\$
6
  • 1
    \$\begingroup\$ +/*<:5&p:^:a:2+i.99 for 19 bytes Try it online! \$\endgroup\$ Commented Dec 4, 2017 at 19:12
  • \$\begingroup\$ For future reference, you can aso use "+ instead of "0, so it could equally become <:#@(5&p:^:a:)"+i.99 \$\endgroup\$ Commented Dec 4, 2017 at 19:25
  • 2
    \$\begingroup\$ 16 bytes with +/1<a:5&p:2+i.99 \$\endgroup\$ Commented Dec 5, 2017 at 2:44
  • 1
    \$\begingroup\$ @ miles : Can you explain the use of a: in your code? How does it work instead of ^:? \$\endgroup\$ Commented Dec 5, 2017 at 7:34
  • 1
    \$\begingroup\$ @GalenIvanov (5&p:)^:a: m can be done as a: 5&p: m using the other definition of & when a dyad is bonded with a noun and then called dyadically. \$\endgroup\$ Commented Dec 5, 2017 at 12:14
4
\$\begingroup\$

JavaScript (ES6), 115 ... 104 99 bytes

Hard-coding might be shorter, but let's try a purely mathematical approach.

f=n=>n>97?6:(P=(n,s=0)=>k--?P(n,s+(C=(a,b)=>b?C(b,a%b):a<2)(n,k)):s>1?1+P(k=s):1)(k=n+2)+' '+f(-~n) console.log(f())

\$\endgroup\$
2
  • \$\begingroup\$ Hard-coding is 90 bytes (pastebin link) \$\endgroup\$ Commented Dec 4, 2017 at 17:09
  • \$\begingroup\$ @HermanLauenstein Nicely done. \$\endgroup\$ Commented Dec 4, 2017 at 17:24
4
\$\begingroup\$

Python 2, 80 bytes

n,_=r=2,0;exec'r+=r[sum(k/n*k%n>n-2for k in range(n*n))]+1,;print r[n];n+=1;'*99 

Try it online!

\$\endgroup\$
3
\$\begingroup\$

Python 2, 82 bytes

l=0,1 exec"n=len(l);p=2\nwhile n%p:p+=1\nl+=l[p-1]+l[n/p]-n%4%3/2,;print l[n];"*99 

Try it online!

This uses the observations that:

  • f(a*b) = f(a) + f(b) - 1, except the -1 is omitted if a and b are both even
  • f(p) = f(p-1) + 1 when p is prime, with f(2)=1

These imply that if n has prime factorization n = 2**a * 3**b * 5**c * 7**d * 11**e * ..., then f(n) = max(a,1) + b + 2*c + 2*d + 3*e + ..., where each p>2 in the factorization contributes f(p-1).

I'm not sure if these continue to hold past n=100, but if they do, they give a way to define and calculate f without using φ.

\$\endgroup\$
3
\$\begingroup\$

Husk, 10 17 bytes

mö←LU¡Sȯṁε⌋ḣtḣ100 

Try it online!

Edit: +7 bytes for actually mapping the function over the range that was asked for, before it was only the function computing A003434.

Explanation

The following computes A003434:

←LU¡S(ṁ(ε⌋))ḣ -- takes a number as input, for example: 39 ¡ -- iterate the following function on the input: [39,24,8,4,2,1,1,1..] S( )ḣ -- with itself (x) and the range [1..x].. ṁ( ) -- ..map and sum the following ε⌋ -- 0 if gcd not 1 else 1 U -- longest unique prefix: [39,24,8,4,2,1] L -- length: 6 ← -- decrement: 5 

The m(....)ḣ100 part just map that function over the range [2..100], not sure how I missed that part before :S

\$\endgroup\$
2
\$\begingroup\$

Bubblegum, 49 bytes

00000000: 5d88 0511 0020 0003 ab2c 024e ff64 e8a3 ].... ...,.N.d.. 00000010: 379f 956b f05d 206c 0545 7274 743a b876 7..k.] l.Ertt:.v 00000020: 2267 27f9 9f4d 9b9d fc85 e7e6 994d 6eb0 "g'..M.......Mn. 00000030: 2b + 

Try it online!

\$\endgroup\$
2
\$\begingroup\$

PowerShell, 110 bytes

$a=,0*101;2..100|%{$i=$_;for($z=$j=0;++$j-lt$i;$z+=$k-eq1){for($k=$j;$j%$k-or$i%$k;$k--){}};($a[$i]=$a[$z]+1)} 

Try it online!

Mathematical approach.

Actually, looking through it, very similar to the C answer, but developed independently. Creates an array of 0s, loops from 2 to 100, then calculates phi using the gcd formulation. The part in parens at the end both saves the result into $a for the next go-round, and places a copy on the pipeline, which results in the implicit output.


PowerShell, 112 bytes

"122323333434344534444545444545555545455645555655565646555656556656665656565656656757566756666667566"-split'(.)' 

Try it online!

Hard-coded. Ho-hum. Shorter than I could get a mathematical approach by about 10-15 bytes.

\$\endgroup\$
3
  • \$\begingroup\$ I wonder whether you actually need a separator, as all the numbers are single digits:) \$\endgroup\$ Commented Dec 4, 2017 at 17:02
  • 1
    \$\begingroup\$ Can you show us your mathematical approach? It looks much more interesting certainly :P \$\endgroup\$ Commented Dec 5, 2017 at 15:18
  • 2
    \$\begingroup\$ @ConorO'Brien Luckily enough, I was able to look at it with fresh eyes this morning and golf the mathematical approach below the hard-coded approach. \$\endgroup\$ Commented Dec 5, 2017 at 16:11
2
\$\begingroup\$

Python 2, 83 bytes

n=2 exec"print len(bin(n))-3+n%2-~n%9/8-(0x951a5fddc040419d4005<<19>>n&1);n+=1;"*99 

Try it online!

Combines a heuristic estimate with a hardcoded constant that corrects each estimate as either -0 or -1.

\$\endgroup\$
1
\$\begingroup\$

PHP, 98 bytes

1,2,<?=join(',',str_split(unpack('H*','##3444E4DEEDEEUUEEVEUVUVVFUVVUfVfVVVVVegWVgVffgV')[1]))?>,6 

Try it online!

I packed all digits into a binary string. After unpacking it, converting it to a an array and then mergin the array again, i only had to prepend the 1,2 and append the 6 as those wouldnt fit or caused a control code to appear.

\$\endgroup\$
1
\$\begingroup\$

Perl 6, 47 bytes

map {($_,{+grep 1==* gcd $_,^$_}...1)-1},2..200 

Try it online!

\$\endgroup\$
1
\$\begingroup\$

05AB1E, 11 bytes

тL¦ε[DNs#sÕ 

Try it online!

Explanation

тL¦ # push range [2 ... 100] ε # apply to each [ # start a loop D # duplicate the current number N # push the loop iteration counter s # swap one copy of the current number to the top of the stack # # if true, break the loop s # swap the second copy of the current number to the top of the stack Õ # calculate eulers totient 
\$\endgroup\$
1
\$\begingroup\$

C, 112 bytes

a[101];f(i,j,k,t){for(a[i=1]=0;i++<100;printf("%d ",a[i]=a[t]+1))for(t=j=0;++j<i;t+=k==1)for(k=j;j%k||i%k;k--);} 

Ungolfed:

a[101]; f(i,j,k,t){ for(a[1]=0,i=2;i<=100;i++) { // initialize for(t=j=0;++j<i;t+=k==1) // count gcd(i, j) == 1 (t = phi(i)) for(k=j;j%k||i%k;k--); // calculate k = gcd(i, j) printf("%d ",a[i]=a[t]+1); // print and store results } } 

Try it online!

\$\endgroup\$
0
\$\begingroup\$

Alumin, 87 bytes

hhhhhdadtqdhcpkkmzyhqkhwzydqhhwdrdhhhwrysrshhwqdrybpkshehhhwrysrarhcpkksyhaydhehycpkkmr 

Try it online!

Explanation

hhhhhdadt CONSTANT 100 RANGE FROM 100 to 0 q dhc p REMOVE 0 AND 1 kk OVER EACH ELEMENT... m zyh q kh wzyd q DUPLICATE TOP TWO ELEMENTS... hhwdrdhhhwrysrshhw GCD... qdryb p ks he hhhw ry s rarhc p IS IT ONE? IF SO TERMINATE (FIXPOINT) kksyhaydhehyc p kk m REVERSE THE VALUES r 
\$\endgroup\$
0
\$\begingroup\$

Pyth, 38 bytes (not competitive)

.e-+1sl+1kb_jC"Éõ4ÕYHø\\uÊáÛ÷â¿"3 

Try it on the Pyth Herokuapp, because it doesn't work on TIO for whatever reason.

I have no doubt the explicit Pyth solution is smaller, but I wanted to see how small I could get the code by compressing the sequence, and learn Pyth I guess. This uses the fact that an upper bound of the sequence is log2(n)+1.

Explanation

.e-+1sl+1kb_jC"Éõ4ÕYHø\\uÊáÛ÷â¿"3 C"Éõ4ÕYHø\\uÊáÛ÷â¿" interpret string as base 256 integer j 3 convert to array of base 3 digits _ invert sequence (original had leading 0s) .e map with enumeration (k=index, b=element) +1k k+1 sl floor(log( )) +1 +1 - b -b 

I got the compressed string via Ci_.e+1-sl+1ksb"122323333434344534444545444545555545455645555655565646555656556656665656565656656757566756666667566"3, which is just the opposite of the code above with a few type conversions.

\$\endgroup\$
2
  • 1
    \$\begingroup\$ Why noncompeting? \$\endgroup\$ Commented Dec 5, 2017 at 18:18
  • \$\begingroup\$ @SimplyBeautifulArt didn't really mean noncompeting in the formal sense; edited the title to make that more clear \$\endgroup\$ Commented Dec 5, 2017 at 18:34
0
\$\begingroup\$

Ohm v2, 41 bytes

“ ‽W3>€þΣÌιZ§Á HgüυH§u·β}Bā€ΣNπáÂUõÚ,3“8B 

Try it online!

Literally completely hardcoded... I actually took the sequence above, stripped everything that wasn't a number, interpreted it as base 8, then turned it into Ohm's built-in base 255 number representation. That's what the quotes do. Then, the program simply turns that into base 8 again.

\$\endgroup\$

Start asking to get answers

Find the answer to your question by asking.

Ask question

Explore related questions

See similar questions with these tags.